PDB entry 4qoa

View 4qoa on RCSB PDB site
Description: Crystal structure of a putative periplasmic protein (BACUNI_04550) from Bacteroides uniformis ATCC 8492 at 2.75 A resolution
Class: structural genomics, unknown function
Keywords: Two copies of DUF2874 domain (PF11396), BLIP-like fold, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-BIOLOGY, UNKNOWN FUNCTION
Deposited on 2014-06-19, released 2014-07-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.217
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Putative periplasmic protein
  Species: Bacteroides uniformis [TaxId:411479]
  Gene: BACUNI_04550
  Database cross-references and differences (RAF-indexed):
  • Uniprot A7VAB9 (1-126)
  Domains in SCOPe 2.05: d4qoaa_
• Heterogens: EDO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4qoaA (A:)
  ggdvitqdtkqlpltarnfinqyfskphishikieseilqtkkyevlltdrteidfdkkg
  nwlevdckksavpealipvpvkeyvkanfpreiitkiergrtgveielgndyslkfnkkg
  kfvsmdd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4qoaA (A:)
  gdvitqdtkqlpltarnfinqyfskphishikieseilqtkkyevlltdrteidfdkkgn
  wlevdckksavpealipvpvkeyvkanfpreiitkiergrtgveielgndyslkfnkkgk
  fvsmdd