PDB entry 4qo4

View 4qo4 on RCSB PDB site
Description: co-crystal structure of MDM2 (17-111) with compound 16, {(3R,5R,6S)-5-(3-CHLOROPHENYL)-6-(4-CHLOROPHENYL)-1-[(1S)-1-(6-CYCLOPROPYLPYRIDIN-2-YL)PROPYL]-3-METHYL-2-OXOPIPERIDIN-3-YL}ACETIC ACID
Class: Ligase/Ligase inhibitor
Keywords: MDM2, p53, protein-protein interaction, inhibitor, Ligase-Ligase inhibitor complex
Deposited on 2014-06-19, released 2014-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-10, with a file datestamp of 2014-09-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.264
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase Mdm2
    Species: Homo sapiens [TaxId:9606]
    Gene: MDM2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qo4a_
  • Heterogens: 35S, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4qo4A (A:)
gsqipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydekqqhiv
ycsndllgdlfgvpsfsvkehrkiytmiyrnlvvvn

    Sequence, based on observed residues (ATOM records): (download) 
    >4qo4A (A:)
qipaseqetlvrpkplllkllksvgaqkdtytmkevlfylgqyimtkrlydhivycsndl
lgdlfgvpsfsvkehrkiytmiyrnlvvv