PDB entry 4qo3

View 4qo3 on RCSB PDB site
Description: Crystal structure of C16S/N18S/K12V/C117V/P134V mutant of human acidic fibroblast growth factor
Class: protein binding
Keywords: Beta-trefoil, growth factor, FGFR binding, heparin binding, PROTEIN BINDING
Deposited on 2014-06-19, released 2015-05-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-05-06, with a file datestamp of 2015-05-01.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (17)
      • engineered mutation (21)
      • engineered mutation (23)
      • engineered mutation (122)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d4qo3a1, d4qo3a2
  • Chain 'B':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (17)
      • engineered mutation (21)
      • engineered mutation (23)
      • engineered mutation (122)
      • engineered mutation (139)
    Domains in SCOPe 2.07: d4qo3b1, d4qo3b2
  • Heterogens: FLC, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qo3A (A:)
    hhhhhhfnlppgnykkpvllysssgghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflvlpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qo3A (A:)
    hhhhfnlppgnykkpvllysssgghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    vkrgprthygqkailflvlpvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qo3B (B:)
    hhhhhhfnlppgnykkpvllysssgghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflvlpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qo3B (B:)
    hhhhfnlppgnykkpvllysssgghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    vkrgprthygqkailflvlpv