PDB entry 4qns

View 4qns on RCSB PDB site
Description: Crystal structure of bromodomain from Plasmodium faciparum GCN5, PF3D7_0823300
Class: transferase
Keywords: Structural Genomics, Structural Genomics Consortium, SGC, bromodomain, histone, malaria, transferase
Deposited on 2014-06-18, released 2014-07-16
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-16, with a file datestamp of 2014-07-11.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.158
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Histone acetyltransferase GCN5, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: gcn5, PF08_0034, PFNF54_02299
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IB67 (1-105)
      • expression tag (0)
    Domains in SCOPe 2.04: d4qnsa_
  • Chain 'B':
    Compound: Histone acetyltransferase GCN5, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: gcn5, PF08_0034, PFNF54_02299
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8IB67 (1-105)
      • expression tag (0)
    Domains in SCOPe 2.04: d4qnsb_
  • Chain 'C':
    Compound: Histone acetyltransferase GCN5, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: gcn5, PF08_0034, PFNF54_02299
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Histone acetyltransferase GCN5, putative
    Species: Plasmodium falciparum [TaxId:36329]
    Gene: gcn5, PF08_0034, PFNF54_02299
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, EDO, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qnsA (A:)
    ghkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgd
    yktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qnsB (B:)
    ghkevqlkdqilgvldylekqqsawpflkpvslseapdyydiikeptdiltmrrkarhgd
    yktkedfgielkrmfdncrlynapttiyfkyanelqtliwpkyeai
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.