PDB entry 4qnk

View 4qnk on RCSB PDB site
Description: The structure of wt A. thaliana IGPD2 in complex with Mn2+ and phosphate
Class: lyase
Keywords: hydro-lyase, histidine biosynthesis, manganese binding, chloroplastic, LYASE
Deposited on 2014-06-18, released 2015-06-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnka1, d4qnka2
  • Chain 'B':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnkb1, d4qnkb2
  • Chain 'C':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnkc1, d4qnkc2
  • Chain 'D':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnkd1, d4qnkd2
  • Chain 'E':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnke1, d4qnke2
  • Chain 'F':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnkf1, d4qnkf2
  • Chain 'G':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnkg1, d4qnkg2
  • Chain 'H':
    Compound: Imidazoleglycerol-phosphate dehydratase 2, chloroplastic
    Species: Arabidopsis thaliana [TaxId:3702]
    Gene: At4g14910, dl3495c, HISN5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qnkh1, d4qnkh2
  • Heterogens: MN, PO4, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qnkA (A:)
    spiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvra
    tgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpyl
    gynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralr
    qatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnkA (A:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qnkB (B:)
    spiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvra
    tgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpyl
    gynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralr
    qatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnkB (B:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qnkC (C:)
    spiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvra
    tgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpyl
    gynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralr
    qatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnkC (C:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qnkD (D:)
    spiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvra
    tgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpyl
    gynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralr
    qatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnkD (D:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qnkE (E:)
    spiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvra
    tgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpyl
    gynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralr
    qatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnkE (E:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4qnkF (F:)
    spiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvra
    tgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpyl
    gynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralr
    qatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnkF (F:)
    arigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdth
    iddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynle
    iptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqates
    dprr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4qnkG (G:)
    spiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvra
    tgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpyl
    gynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralr
    qatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnkG (G:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4qnkH (H:)
    spiesarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvra
    tgdthiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpyl
    gynleiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralr
    qatesdprrggtipsskgvlsrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qnkH (H:)
    sarigevkretketnvsvkinldghgvsdsstgipfldhmldqlashglfdvhvratgdt
    hiddhhtnedvalaigtallkalgerkginrfgdftapldealihvsldlsgrpylgynl
    eiptqrvgtydtqlvehffqslvntsgmtlhirqlagknshhiieatfkafaralrqate
    sdprr