PDB entry 4qn5

View 4qn5 on RCSB PDB site
Description: Neuraminidase N5 binds LSTa at the second SIA binding site
Class: hydrolase
Keywords: 6-bladed beta-propeller, hydrolase, calcium binding, glycosylation
Deposited on 2014-06-17, released 2014-07-30
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.12
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (A/mallard duck/ALB/60/1976(H12N5)) [TaxId:352705]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4qn5a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus (A/mallard duck/ALB/60/1976(H12N5)) [TaxId:352705]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4qn5b_
  • Heterogens: CA, NAG, SIA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qn5A (A:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qn5A (A:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qn5B (B:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qn5B (B:)
    peflnnteplcnvsgfaivskdngirigsrghvfvirepfvacgptecrtffltqgalln
    dkhsnntvkdrspyralmsvplgsspnayqakfesvawsatachdgkkwlavgisgaddd
    ayavihyggmptdvvrswrkqilrtqesscvcmngncywvmtdgpansqasykifksheg
    mvtnerevsfqgghieecscypnlgkvecvcrdnwngmnrpilifdedldyevgylcagi
    ptdtprvqdssftgsctnavggsgtnnygvkgfgfrqgnsvwagrtvsissrsgfeilli
    edgwirtsktivkkvevlnnknwsgysgaftipitmtskqclvpcfwlemirgkpeerts
    iwtsssstvfcgvssevpgwswddgailpfdidk