PDB entry 4qn3

View 4qn3 on RCSB PDB site
Description: Crystal structure of Neuraminidase N7
Class: hydrolase
Keywords: 6-bladed beta-propeller, hydrolase, calcium binding, glycosylation
Deposited on 2014-06-17, released 2014-07-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.176
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (A/mallard/ALB/196/1996(H10N7)) [TaxId:352589]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qn3a_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus (A/mallard/ALB/196/1996(H10N7)) [TaxId:352589]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qn3b_
  • Heterogens: CA, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qn3A (A:)
    nylmlnkslckvegwvvvakdnairfgeseqiivtrepyvscdplgckmyalhqgttirn
    khsngtihdrtafrglistplgsppivsnsdflcvgwsstschdgigrmticvqgnndna
    tatvyydrrltttiktwagnilrtqesecvchngtcvvimtdgsassqaytkvlyfhkgl
    vikeealkgsarhieecscyghnskvtcvcrdnwqganrpvieidmnamehtsqylctgv
    ltdtsrpsdksigdcnnpitgspgapgvkgfgfldsgntwlgrtisprsrsgfemlkipn
    agtdpnsriterqeivdnnnwsgysgsfidywdessecynpcfyvelirgrpeeakyvww
    tsnslvalcgspvpvgsgsfpdgaqiqyfs
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qn3B (B:)
    nylmlnkslckvegwvvvakdnairfgeseqiivtrepyvscdplgckmyalhqgttirn
    khsngtihdrtafrglistplgsppivsnsdflcvgwsstschdgigrmticvqgnndna
    tatvyydrrltttiktwagnilrtqesecvchngtcvvimtdgsassqaytkvlyfhkgl
    vikeealkgsarhieecscyghnskvtcvcrdnwqganrpvieidmnamehtsqylctgv
    ltdtsrpsdksigdcnnpitgspgapgvkgfgfldsgntwlgrtisprsrsgfemlkipn
    agtdpnsriterqeivdnnnwsgysgsfidywdessecynpcfyvelirgrpeeakyvww
    tsnslvalcgspvpvgsgsfpdgaqiqyfs