PDB entry 4qme

View 4qme on RCSB PDB site
Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe
Class: hydrolase
Keywords: APN, alanine aminopeptidase, M1 peptidase, 3-{[(R)-1-amino-3-phenylpropyl](hydroxy)phosphoryl}-(S)-2-benzylpropanoic acid, HYDROLASE
Deposited on 2014-06-16, released 2014-10-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.145
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Neisseria meningitidis MC58 [TaxId:122586]
    Gene: pepN, NMB1416
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qmea1, d4qmea2, d4qmea3, d4qmea4
  • Heterogens: 37B, ZN, GOL, IMD, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qmeA (A:)
    sktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvk
    ingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegf
    rkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsy
    lfalvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgley
    dldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtg
    nrvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvr
    pasyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraam
    adanginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkv
    gllnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypy
    sdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisdd
    lldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaakq
    enqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavngn
    esdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnkar
    sligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknlv
    kqalqriraqeglskdvgeivgkild