PDB entry 4qmc

View 4qmc on RCSB PDB site
Description: Crystal structure of complex formed between phospholipase A2 and Biotin-sulfoxide at 1.09 A Resolution
Class: hydrolase
Keywords: Hydrolase
Deposited on 2014-06-16, released 2014-07-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-30, with a file datestamp of 2014-07-25.
Experiment type: XRAY
Resolution: 1.09 Å
R-factor: 0.19
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phospholipase A2 VRV-PL-VIIIa
    Species: Daboia russellii pulchella [TaxId:97228]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4qmca_
  • Heterogens: GOL, BSO, SO4, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qmcA (A:)
    sllefgkmileetgklaipsyssygcycgwggkgtpkdatdrccfvhdccygnlpdcnpk
    sdrykykrvngaivcekgtscenricecdkaaaicfrqnlntyskkymlypdflckgelk
    c