PDB entry 4qlw

View 4qlw on RCSB PDB site
Description: Azurin mutant M121E with iron
Class: Electron transport
Keywords: azurin, M121E, iron, Electron transport
Deposited on 2014-06-13, released 2014-08-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-10-01, with a file datestamp of 2014-09-26.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4qlwa_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4qlwb_
  • Chain 'C':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4qlwc_
  • Chain 'D':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:208964]
    Gene: AZU, PA4922
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered mutation (120)
    Domains in SCOPe 2.07: d4qlwd_
  • Heterogens: SO4, NO3, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qlwA (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    ekgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qlwB (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    ekgtltlk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qlwC (C:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    ekgtltlk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qlwD (D:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tdgmasgldkdylkpddsrviahtkligsgekdsvtfdvsklkegeqymffctfpghsal
    ekgtltlk