PDB entry 4qlr

View 4qlr on RCSB PDB site
Description: Llama nanobody n02 raised against EAEC T6SS TssM
Class: immune system
Keywords: nanobody, immunoglobulin domain, T6SS TssM, IMMUNE SYSTEM
Deposited on 2014-06-13, released 2015-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Llama nanobody n02 VH domain
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4QLR (0-129)
    Domains in SCOPe 2.07: d4qlra1, d4qlra2
  • Chain 'B':
    Compound: Llama nanobody n02 VH domain
    Species: Lama glama [TaxId:9844]
    Database cross-references and differences (RAF-indexed):
    • PDB 4QLR
    Domains in SCOPe 2.07: d4qlrb1, d4qlrb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qlrA (A:)
    dvqlvesggglvhpggslrlscaasgrtfsdyalgwfrqapgkdrefvaaiswsggstyy
    adsvqgrftisrdndknsvylqmnslkpedtavyycaadkyytgpggesvydywgrgtqv
    tvsshhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qlrB (B:)
    dvqlvesggglvhpggslrlscaasgrtfsdyalgwfrqapgkdrefvaaiswsggstyy
    adsvqgrftisrdndknsvylqmnslkpedtavyycaadkyytgpggesvydywgrgtqv
    tvsshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qlrB (B:)
    vqlvesggglvhpggslrlscaasgrtfsdyalgwfrqapgkdrefvaaiswsggstyya
    dsvqgrftisrdndknsvylqmnslkpedtavyycaadkyytgpggesvydywgrgtqvt
    vs