PDB entry 4qlj

View 4qlj on RCSB PDB site
Description: Crystal structure of rice BGlu1 E386G/Y341A/Q187A mutant complexed with cellotetraose
Class: hydrolase
Keywords: beta-alpha-barrels, glycosynthase, oligosaccharide synthesis, transglucosylation, hydrolase
Deposited on 2014-06-12, released 2015-06-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-17, with a file datestamp of 2015-06-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase 7
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: BGLU1, BGLU7, LOC_Os03g49600, Os03g0703000, Os3BGlu7, OSJNBa0004L11.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75I93 (Start-480)
      • see remark 999 (28)
      • engineered mutation (191)
      • engineered mutation (345)
      • engineered mutation (390)
    Domains in SCOPe 2.07: d4qlja_
  • Chain 'B':
    Compound: Beta-glucosidase 7
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: BGLU1, BGLU7, LOC_Os03g49600, Os03g0703000, Os3BGlu7, OSJNBa0004L11.16
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q75I93 (Start-480)
      • see remark 999 (28)
      • engineered mutation (191)
      • engineered mutation (345)
      • engineered mutation (390)
    Domains in SCOPe 2.07: d4qljb_
  • Heterogens: CTT, ZN, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qljA (A:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    eprivallgydagtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtavfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitgngmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qljA (A:)
    nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
    dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
    yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallg
    ydagtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
    nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
    gsadyiginqytasymkgqqlmqqtptsysadwqvtavfakngkpigpqansnwlyivpw
    gmygcvnyikqkygnptvvitgngmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
    anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qljB (B:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    eprivallgydagtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtavfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitgngmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qljB (B:)
    nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
    dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
    yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfneprivallg
    ydagtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
    nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
    gsadyiginqytasymkgqqlmqqtptsysadwqvtavfakngkpigpqansnwlyivpw
    gmygcvnyikqkygnptvvitgngmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
    anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh