PDB entry 4ql3

View 4ql3 on RCSB PDB site
Description: Crystal Structure of a GDP-bound G12R Oncogenic Mutant of Human GTPase KRas
Class: hydrolase
Keywords: small gtpase, signal transduction, GDP binding, GTP binding,hydrolase, hydrolase
Deposited on 2014-06-10, released 2015-06-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-09-30, with a file datestamp of 2015-09-25.
Experiment type: XRAY
Resolution: 1.04 Å
R-factor: N/A
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTPase KRas
    Species: Homo sapiens [TaxId:9606]
    Gene: KRAS, KRAS2, RASK2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01116 (1-169)
      • expression tag (0)
      • engineered mutation (12)
    Domains in SCOPe 2.08: d4ql3a1, d4ql3a2
  • Heterogens: GDP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4ql3A (A:)
gmteyklvvvgargvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildta
gqeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcd
lpsrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhkek