PDB entry 4qkq

View 4qkq on RCSB PDB site
Description: RadA from Methanococcus Voltae in complex with copper phthalocyanine tetrasulfonate inhibitor
Class: DNA binding protein
Keywords: RadA, Rad51, DMC1, RecA, ATPase, DNA strand Exchange, Homologous Recombination, RECA FOLD, ATP binding, DNA binding, DNA BINDING PROTEIN
Deposited on 2014-06-09, released 2015-06-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-24, with a file datestamp of 2015-06-19.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqa1, d4qkqa2
  • Chain 'B':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqb1, d4qkqb2
  • Chain 'C':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqc1, d4qkqc2
  • Chain 'D':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqd1, d4qkqd2
  • Chain 'E':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqe1, d4qkqe2
  • Chain 'F':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqf1, d4qkqf2
  • Chain 'G':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqg1, d4qkqg2
  • Chain 'H':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqh1, d4qkqh2
  • Chain 'I':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqi1, d4qkqi2
  • Chain 'J':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqj1, d4qkqj2
  • Chain 'K':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkqk1, d4qkqk2
  • Chain 'L':
    Compound: DNA repair and recombination protein radA
    Species: Methanococcus voltae [TaxId:2188]
    Gene: RADA
    Database cross-references and differences (RAF-indexed):
    • Uniprot O73948 (4-265)
      • expression tag (1-3)
    Domains in SCOPe 2.07: d4qkql1, d4qkql2
  • Heterogens: NO3, 35N, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qkqA (A:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqA (A:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qkqB (B:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqB (B:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qkqC (C:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqC (C:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qkqD (D:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqD (D:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qkqE (E:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqE (E:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4qkqF (F:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqF (F:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4qkqG (G:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqG (G:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4qkqH (H:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqH (H:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4qkqI (I:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqI (I:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4qkqJ (J:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqJ (J:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >4qkqK (K:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqK (K:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >4qkqL (L:)
    gshmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimh
    qscvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldn
    tfvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgr
    hmatlnkladlfncvvlvtnqvsakpdaffgmaeqaigghivghaatfrffvrkgkgdkr
    vaklydsphlpdaeaifritekgiqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qkqL (L:)
    shmdlgfksgidllkqrstvwklstssseldsvlggglesqsvtefagvfgsgktqimhq
    scvnlqnpeflfydeeavskgevaqpkavyidtegtfrperimqmaehagidgqtvldnt
    fvaraynsdmqmlfaekiedliqegnniklvvidsltstfrneytgrgklaerqqklgrh
    matlnkladlfncvvlvtnqvsaaeqaigghivghaatfrffvrkgkgdkrvaklydsph
    lpdaeaifritekgiqd