PDB entry 4qjb

View 4qjb on RCSB PDB site
Description: Crystal structure of the sugar phosphatase PfHAD1 from Plasmodium falciparum
Class: hydrolase
Keywords: HAD-like hydrolase, HAD Rossmanoid fold, three-layered alpha-beta-alpha sandwich, Sugar Phosphatase, hydrolase
Deposited on 2014-06-03, released 2014-07-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF10_0325, PF3D7_1033400
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Haloacid dehalogenase-like hydrolase
    Species: PLASMODIUM FALCIPARUM [TaxId:36329]
    Gene: PF10_0325, PF3D7_1033400
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4qjbb_
  • Heterogens: MG, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qjbB (B:)
    mahhhhhhmheivdkngkkvqknnlndeikiiftdldgtllnsenkvseqnlesliraqe
    kgikvviatgrsifsvenvigehvkknrisllpgiymngcvtfdekgsrvidrimnndlk
    meihefskqiniskyaiwfclektycfeindcireymevealnpdviednmlegltvykv
    lfslpenilentlklcrekfshrinvantfqsyvelfhqhtnkfegvkeickyynislnn
    alamgdgendiemlsglthsvgvhnasekvknsaayvgpsnnehaishvlktfcdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qjbB (B:)
    eikiiftdldgtllnsenkvseqnlesliraqekgikvviatgrsifsvenvigehvkkn
    risllpgiymngcvtfdekgsrvidrimnndlkmeihefskqiniskyaiwfclektycf
    eindcireymevealnpdviednmlegltvykvlfslpenilentlklcrekfshrinva
    ntfqsyvelfhqhtnkfegvkeickyynislnnalamgdgendiemlsglthsvgvhnas
    ekvknsaayvgpsnnehaishvlktfc