PDB entry 4qip

View 4qip on RCSB PDB site
Description: Crystal Structure of Major Birch Pollen Allergen Bet v 1 isoform a in complex with Sodium Dodecyl Sulfate
Class: allergen
Keywords: ALLERGEN, PR-10 PROTEIN, Bet v 1-like Superfamily, Defense Response, Response to Biotic Stimulus
Deposited on 2014-06-01, released 2015-01-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-01-14, with a file datestamp of 2015-01-09.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.247
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: major pollen allergen bet v 1-a
    Species: Betula pendula [TaxId:3505]
    Gene: BETVIA, BETVI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4qipa_
  • Heterogens: SDS, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qipA (A:)
    gvfnyetettsvipaarlfkafildgdnlfpkvapqaissveniegnggpgtikkisfpe
    gfpfkyvkdrvdevdhtnfkynysvieggpigdtlekisneikivatpdggsilkisnky
    htkgdhevkaeqvkaskemgetllravesyllahsdayn