PDB entry 4qhp

View 4qhp on RCSB PDB site
Description: Crystal structure of Aminopeptidase N in complex with the phosphinic dipeptide analogue LL-(R,S)-hPheP[CH2]Phe(4-CH2NH2)
Class: hydrolase/hydrolase inhibitor
Keywords: Zn-dependent, APN, (S)-2-[4-(aminomethyl)benzyl]-3-[(R)-1-amino-3-phenylpropyl(hydroxy)phosphoryl]propanoic acid, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-05-28, released 2014-09-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.155
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aminopeptidase N
    Species: Neisseria meningitidis [TaxId:487]
    Gene: pepN, NMB1416
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4qhpa1, d4qhpa2, d4qhpa3, d4qhpa4
  • Heterogens: 32Q, 32R, IMD, GOL, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qhpA (A:)
    snamsktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakl
    lsvkingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqce
    pegfrkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfs
    kpsylfalvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrf
    gleydldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfh
    nwtgnrvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagpta
    hpvrpasyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddf
    raamadanginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmi
    pvkvgllnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhl
    nypysdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekv
    isddlldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrq
    aakqenqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsa
    vngnesdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenp
    nkarsligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephr
    knlvkqalqriraqeglskdvgeivgkild
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qhpA (A:)
    sktvhylkdyqtpayhilktdlhfdinepqtvvksrltvepqrvgeplvldgsakllsvk
    ingaaadyvlegetltiagvpserftveveteilpaenkslmglyasggnlftqcepegf
    rkitfyidrpdvmskftttivadkkrypvllsngnkidggefsdgrhwvkwedpfskpsy
    lfalvagdlavtedyfttmsgrnvkiefytteadkpkvgfaveslknamkwdetrfgley
    dldifmvvavgdfnmgamenkglnifntkfvladsrtatdtdfegiesvvgheyfhnwtg
    nrvtcrdwfqlslkegltvfrdqefsgdrasravrrienirllrqhqfpedagptahpvr
    pasyeemnnfytmtvyekgaevvrmyhtllgeegfqkgmklyfqrhdgqavtcddfraam
    adanginldqfalwysqagtpvleaegrlknnifeltvkqtvpptpdmtdkqpmmipvkv
    gllnrngeavafdyqgkrateavlllteaeqtfllegvteavvpsllrgfsapvhlnypy
    sdddlllllahdsdaftrweaaqtlyrravaanlatlsdgvelpkhekllaavekvisdd
    lldnafkalllgvpseaelwdgaenidplryhqarealldtlavhflpkwhelnrqaakq
    enqsyeyspeaagwrtlrnvcrafvlradpahietvaekygemaqnmthewgilsavngn
    esdtrnrllaqfadkfsddalvmdkyfalvgssrrsdtlqqvrtalqhpkfslenpnkar
    sligsfsrnvphfhaedgsgyrfiadkvieidrfnpqvaarlvqafnlcnklephrknlv
    kqalqriraqeglskdvgeivgkild