PDB entry 4qgw

View 4qgw on RCSB PDB site
Description: Crystal sturcture of the R132K:R111L:L121D mutant of Cellular Retinoic Acid Binding ProteinII complexed with a synthetic ligand (Merocyanine) at 1.77 angstrom resolution
Class: protein binding
Keywords: Protein Engineering, Protein Fluorescence, Merocyanine dyes for fluorescent protein labeling, Fluorescent protein tag, Merocyanine Protonated Schiff Base Iminium, PROTEIN BINDING
Deposited on 2014-05-26, released 2015-01-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-02-11, with a file datestamp of 2015-02-06.
Experiment type: XRAY
Resolution: 1.77 Å
R-factor: 0.195
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered mutation (110)
      • engineered mutation (120)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d4qgwa_
  • Chain 'B':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered mutation (110)
      • engineered mutation (120)
      • engineered mutation (131)
    Domains in SCOPe 2.07: d4qgwb_
  • Heterogens: LMC, B3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qgwA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
    dtmtaddvvctkvyvre
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4qgwB (B:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
    dtmtaddvvctkvyvre