PDB entry 4qfi

View 4qfi on RCSB PDB site
Description: The crystal structure of rat angiogenin-heparin complex
Class: hydrolase
Keywords: catalytic, angiogenesis, Heparin, HYDROLASE
Deposited on 2014-05-21, released 2014-08-27
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-08-27, with a file datestamp of 2014-08-22.
Experiment type: XRAY
Resolution: 1.78 Å
R-factor: 0.233
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ang, Ang1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4qfia_
  • Chain 'B':
    Compound: angiogenin
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Ang, Ang1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4qfib_
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qfiA (A:)
    gshmaqddprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsika
    icgangspygenlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfd
    esfisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qfiA (A:)
    dprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsikaicgangs
    pygenlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfdesf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qfiB (B:)
    gshmaqddprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsika
    icgangspygenlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfd
    esfisl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qfiB (B:)
    dprytkfltqhydakpkgrdarycesmmrrrgltspckevntfihgnkgsikaicgangs
    pygenlrisqspfqittckhtggsprppcryrasagfrhvviacenglpvhfdesfi