PDB entry 4qf4

View 4qf4 on RCSB PDB site
Description: Crystal structure of Staphylococcal nuclease variant V23M at cryogenic temperature
Class: hydrolase
Keywords: Staphylococcal nuclease, hydrolase, pdtp, cavity, pressure
Deposited on 2014-05-19, released 2014-06-04
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-06-04, with a file datestamp of 2014-05-30.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
    Domains in SCOPe 2.05: d4qf4a_
  • Chain 'B':
    Compound: Thermonuclease
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: nuc
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00644
      • engineered mutation (22)
    Domains in SCOPe 2.05: d4qf4b_
  • Heterogens: THP, CA, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qf4A (A:)
    atstkklhkepatlikaidgdtmklmykgqpmtfrlllvdtpetkhpgkkvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf4A (A:)
    lhkepatlikaidgdtmklmykgqpmtfrlllvdtpetkhpvekygpeasaftkkmvena
    kkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlrkse
    aqakkeklniws
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qf4B (B:)
    atstkklhkepatlikaidgdtmklmykgqpmtfrlllvdtpetkhpgkkvekygpeasa
    ftkkmvenakkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnnt
    heqhlrkseaqakkeklniwsednadsgq
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qf4B (B:)
    lhkepatlikaidgdtmklmykgqpmtfrlllvdtpetkhpvekygpeasaftkkmvena
    kkievefdkgqrtdkygrglayiyadgkmvnealvrqglakvayvykpnntheqhlrkse
    aqakkeklniws