PDB entry 4qew

View 4qew on RCSB PDB site
Description: Crystal structure of BRD2(BD2) mutant with ligand ET bound (METHYL (2R)- 2-[(4S)-6-(4-CHLOROPHENYL)-8-METHOXY-1-METHYL-4H-[1,2,4]TRIAZOLO[4,3-A][1, 4]BENZODIAZEPIN-4-YL]BUTANOATE)
Class: transcription/transcription inhibitor
Keywords: Bromodomain-containing protein 2, KIAA9001, RING3, Transcription regulation, transcription-transcription inhibitor complex
Deposited on 2014-05-19, released 2014-10-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (2-113)
      • engineered mutation (41)
    Domains in SCOPe 2.08: d4qewa_
  • Heterogens: GOL, 2PE, 31P, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4qewA (A:)
smgklseqlkhcngilkellskkhaayawpfykpvdasalgahdyhdiikhpmdlstvkr
kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd

    Sequence, based on observed residues (ATOM records): (download) 
    >4qewA (A:)
gklseqlkhcngilkellskkhaayawpfykpvdasalgahdyhdiikhpmdlstvkrkm
enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd