PDB entry 4qev

View 4qev on RCSB PDB site
Description: Crystal structure of BRD2(BD2) mutant with ligand ME bound (METHYL (2R)- 2-[(4S)-6-(4-CHLOROPHENYL)-8-METHOXY-1-METHYL-4H-[1,2,4]TRIAZOLO[4,3-A][1, 4]BENZODIAZEPIN-4-YL]PROPANOATE)
Class: transcription/transcription inhibitor
Keywords: Bromodomain-containing protein 2, KIAA9001, RING3, Transcription regulation, transcription-transcription inhibitor complex
Deposited on 2014-05-19, released 2014-10-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Bromodomain-containing protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: BRD2, KIAA9001, RING3
  Database cross-references and differences (RAF-indexed):
  • Uniprot P25440 (Start-113)
    • engineered mutation (41)
  Domains in SCOPe 2.07: d4qeva_
• Heterogens: 31O, 2PE, NI, GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >4qevA (A:)
  smgklseqlkhcngilkellskkhaayawpfykpvdasalgahdyhdiikhpmdlstvkr
  kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >4qevA (A:)
  lseqlkhcngilkellskkhaayawpfykpvdasalgahdyhdiikhpmdlstvkrkmen
  rdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd