PDB entry 4qeu

View 4qeu on RCSB PDB site
Description: Crystal structure of BRD2(BD2) mutant in free form
Class: transcription
Keywords: Bromodomain-containing protein 2, KIAA9001, RING3, Transcription regulation, TRANSCRIPTION
Deposited on 2014-05-19, released 2014-10-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2015-07-22, with a file datestamp of 2015-07-17.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD2, KIAA9001, RING3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25440 (2-113)
      • engineered mutation (41)
    Domains in SCOPe 2.08: d4qeua_
  • Heterogens: ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qeuA (A:)
    smgklseqlkhcngilkellskkhaayawpfykpvdasalgahdyhdiikhpmdlstvkr
    kmenrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qeuA (A:)
    gklseqlkhcngilkellskkhaayawpfykpvdasalgahdyhdiikhpmdlstvkrkm
    enrdyrdaqefaadvrlmfsncykynppdhdvvamarklqdvfefryakmpd