PDB entry 4qc6

View 4qc6 on RCSB PDB site
Description: Crystal structure of aminoglycoside 6'-acetyltransferase-Ie
Deposited on 2014-05-09, released 2014-10-22
The last revision was dated 2014-10-22, with a file datestamp of 2014-10-17.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.148
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus warneri [TaxId:1292]
    Gene: aacA-aphD
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Bifunctional AAC/APH
    Species: Staphylococcus warneri [TaxId:1292]
    Gene: aacA-aphD
    Database cross-references and differences (RAF-indexed):
  • Heterogens: KAN, 30N, FMT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4qc6A (A:)
mniveneicirtlidddfplmlkwltdervlefyggrdkkytleslkkhytepwedevfr
viieynnvpigygqiykmydelytdyhypktdeivygmdqfigepnywskgigtryikli
feflkkernanavildphknnprairayqksgfriiedlpehelhegkkedcylmeyry

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >4qc6B (B:)
mniveneicirtlidddfplmlkwltdervlefyggrdkkytleslkkhytepwedevfr
viieynnvpigygqiykmydelytdyhypktdeivygmdqfigepnywskgigtryikli
feflkkernanavildphknnprairayqksgfriiedlpehelhegkkedcylmeyry