PDB entry 4qc3
View 4qc3 on RCSB PDB site
Description: Crystal structure of human BAZ2B bromodomain in complex with a diacetylated histone 4 peptide (H4K8acK12ac)
Class: transcription
Keywords: Bromodomain adjacent to zinc finger domain protein 2B, hWALp4, KIAA1476, transcriptional regulation, Structural Genomics Consortium, SGC, TRANSCRIPTION
Deposited on
2014-05-09, released
2014-05-21
The last revision prior to the SCOPe 2.08 freeze date was dated
2015-04-22, with a file datestamp of
2015-04-17.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Bromodomain adjacent to zinc finger domain protein 2B
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2B, KIAA1476
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4qc3a1, d4qc3a2 - Chain 'B':
Compound: Bromodomain adjacent to zinc finger domain protein 2B
Species: Homo sapiens [TaxId:9606]
Gene: BAZ2B, KIAA1476
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d4qc3b1, d4qc3b2 - Chain 'C':
Compound: diacetylated histone 4 peptide (H4K8acK12ac)
Database cross-references and differences (RAF-indexed):
- Heterogens: EDO, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>4qc3A (A:)
smdskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstireklssgqy
pnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4qc3B (B:)
smdskdlalcsmiltemethedawpfllpvnlklvpgykkvikkpmdfstireklssgqy
pnletfaldvrlvfdncetfneddsdigraghnmrkyfekkwtdtfk
- Chain 'C':
No sequence available.