PDB entry 4qbv

View 4qbv on RCSB PDB site
Description: Crystal structure of C117T mutant of human acidic fibroblast growth factor in sodium citrate buffer
Class: protein binding
Keywords: Beta-trefoil, growth factor, FGFR binding, heparin binding, PROTEIN BINDING
Deposited on 2014-05-08, released 2015-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (122)
    Domains in SCOPe 2.06: d4qbva1, d4qbva2
  • Chain 'B':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (122)
    Domains in SCOPe 2.06: d4qbvb1, d4qbvb2
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qbvA (A:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gstkrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qbvA (A:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    tkrgprthygqkailflplpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qbvB (B:)
    hhhhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gstkrgprthygqkailflplpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qbvB (B:)
    hhhhfnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevyi
    kstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkngs
    tkrgprthygqkailflplpv