PDB entry 4qbo

View 4qbo on RCSB PDB site
Description: VRR_NUC domain
Class: hydrolase
Keywords: nuclease, HYDROLASE
Deposited on 2014-05-08, released 2014-09-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-22, with a file datestamp of 2017-11-17.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: N/A
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nuclease
  Species: Streptococcus phage P9 [TaxId:403905]
  Database cross-references and differences (RAF-indexed):
  • Uniprot A7J283 (2-91)
    • expression tag (0-1)
  Domains in SCOPe 2.08: d4qboa1, d4qboa2
• Heterogens: MG, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4qboA (A:)
  gsmrtekdienylkkktkglclkftspgtigvpdrivvmntgtffvevkapgkkprpsqv
  amhkkikeagqhvwvvdsyesvdmalkemenw