PDB entry 4qau

View 4qau on RCSB PDB site
Description: Crystal structure of F43Y mutant of sperm whale myoglobin
Class: oxygen transport
Keywords: alpha helix boundle, oxygen transport, F43Y mutant
Deposited on 2014-05-06, released 2015-01-21
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-01-21, with a file datestamp of 2015-01-16.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.18
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (Start-153)
      • engineered mutation (43)
    Domains in SCOPe 2.05: d4qaua_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qauA (A:)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekydrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgdfgadaqgamnkalelfrkdiaakykelgyqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qauA (A:)
    vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekydrfkhlkteaemkased
    lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
    gdfgadaqgamnkalelfrkdiaakykelgyqg