PDB entry 4qao

View 4qao on RCSB PDB site
Description: Lysine-ligated cytochrome c with F82H
Class: electron transport
Keywords: electron transport
Deposited on 2014-05-05, released 2015-08-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-17, with a file datestamp of 2019-07-12.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-103)
      • conflict (74)
      • engineered mutation (80-81)
      • engineered mutation (84)
      • expression tag (104-105)
    Domains in SCOPe 2.08: d4qaoa1, d4qaoa2
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-103)
      • conflict (74)
      • engineered mutation (80-81)
      • engineered mutation (84)
      • expression tag (104-105)
    Domains in SCOPe 2.08: d4qaob1, d4qaob2
  • Chain 'C':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-103)
      • conflict (74)
      • engineered mutation (80-81)
      • engineered mutation (84)
      • expression tag (104-105)
    Domains in SCOPe 2.08: d4qaoc1, d4qaoc2
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4qaoA (A:)
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkkase

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4qaoB (B:)
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkkase

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4qaoC (C:)
fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
lwdennmseyltnpakyipgcgmahgglkkekdrndlitylkkase