PDB entry 4qac

View 4qac on RCSB PDB site
Description: X-RAY STRUCTURE OF ACETYLCHOLINE BINDING PROTEIN (ACHBP) IN COMPLEX WITH 4-(4-methylpiperidin-1-yl)-6-(4-(trifluoromethyl)phenyl)pyrimidin-2-amine
Class: Acetylcholine-Binding Protein
Keywords: Acetylcholine-Binding Protein
Deposited on 2014-05-03, released 2014-07-16
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-08-13, with a file datestamp of 2014-08-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.202
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (0-7)
    Domains in SCOPe 2.06: d4qaca1, d4qaca2
  • Chain 'B':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (6-7)
    Domains in SCOPe 2.06: d4qacb1, d4qacb2
  • Chain 'C':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (0-7)
    Domains in SCOPe 2.06: d4qacc1, d4qacc2
  • Chain 'D':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-216)
      • expression tag (0-7)
    Domains in SCOPe 2.06: d4qacd1, d4qacd2
  • Chain 'E':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (1-7)
    Domains in SCOPe 2.06: d4qace1, d4qace2
  • Chain 'F':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (0-7)
    Domains in SCOPe 2.06: d4qacf1, d4qacf2
  • Chain 'G':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (0-7)
    Domains in SCOPe 2.06: d4qacg1, d4qacg2
  • Chain 'H':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (0-7)
    Domains in SCOPe 2.06: d4qach1, d4qach2
  • Chain 'I':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (0-7)
    Domains in SCOPe 2.06: d4qaci1, d4qaci2
  • Chain 'J':
    Compound: acetylcholine-binding protein
    Species: Lymnaea stagnalis [TaxId:6523]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P58154 (8-End)
      • expression tag (3-7)
    Domains in SCOPe 2.06: d4qacj1, d4qacj2
  • Heterogens: PO4, NAG, KK3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4qacA (A:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacA (A:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildv
    tqkknsvtysccpeayedvevslnfrkkg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4qacB (B:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacB (B:)
    dkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttw
    sdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsir
    qrfscdvsgvdtesgatcrikigswthhsreisvdpttsddseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4qacC (C:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacC (C:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvt
    qkknsvtysccpeayedvevslnfrkkg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4qacD (D:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacD (D:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildv
    tqkknsvtysccpeayedvevslnfrkkgrsei
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >4qacE (E:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacE (E:)
    ykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfw
    qqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevly
    mpsirqrfscdvsgvdtesgatcrikigswthhsreisvdptensddseyfsqysrfeil
    dvtqkknsvtysccpeayedvevslnfrkkg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >4qacF (F:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacF (F:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >4qacG (G:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacG (G:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdptddseyfsqysrfeildv
    tqkknsvtysccpeayedvevslnfrkkg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >4qacH (H:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacH (H:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdptsddseyfsqysrfeild
    vtqkknsvtysccpeayedvevslnfrkkg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >4qacI (I:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacI (I:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvt
    qkknsvtysccpeayedvevslnfrkkg
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >4qacJ (J:)
    dykddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvf
    wqqttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevl
    ympsirqrfscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfe
    ildvtqkknsvtysccpeayedvevslnfrkkgrsei
    

    Sequence, based on observed residues (ATOM records): (download)
    >4qacJ (J:)
    ddddkldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqq
    ttwsdrtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlymp
    sirqrfscdvsgvdtesgatcrikigswthhsreisvdptdseyfsqysrfeildvtqkk
    nsvtysccpeayedvevslnfrkkg