PDB entry 4q9x

View 4q9x on RCSB PDB site
Description: mTFP* PdCl2 soak
Class: fluorescent protein
Keywords: artificial metalloenzyme, metalloenzyme, bioconjugation, fluorescent protein, protein design, thermostable, temperature stable, solvent stable, robust
Deposited on 2014-05-02, released 2014-05-21
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-05-21, with a file datestamp of 2014-05-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.178
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GFP-like fluorescent chromoprotein cFP484
    Species: Clavularia sp. [TaxId:86521]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y3 (1-End)
      • engineered mutation (20)
      • engineered mutation (37)
      • engineered mutation (39)
      • engineered mutation (57-58)
      • chromophore (61)
      • engineered mutation (65)
      • engineered mutation (73-74)
      • engineered mutation (106)
      • engineered mutation (116-118)
      • engineered mutation (120)
      • engineered mutation (134-135)
      • engineered mutation (137-138)
      • engineered mutation (142)
      • engineered mutation (151)
      • engineered mutation (154-155)
      • engineered mutation (157)
      • engineered mutation (165)
      • engineered mutation (168)
      • engineered mutation (172)
      • engineered mutation (175)
      • engineered mutation (179)
      • engineered mutation (197)
      • engineered mutation (206)
      • engineered mutation (209)
      • engineered mutation (214)
    Domains in SCOPe 2.06: d4q9xa_
  • Heterogens: PD, CL, CO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q9xA (A:)
    sgvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydiltta
    fxnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkg
    enfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakka
    vklpdyhfvdhrieilnydkdynkvtvyesavarnstd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q9xA (A:)
    gvikpdmkiklkmegnvngyafviegegegkpydgtntinlevkegaplpfsydilttaf
    xnraftkypddipnyfkqsfpegyswertmtfedkgivkvksdisleedsfiyeiylkge
    nfppngpvmqkkttgwdastermyvrdgvlkgdvkhklllegggyyrvdfktiyrakkav
    klpdyhfvdhrieilnydkdynkvtvyesavarn