PDB entry 4q9g

View 4q9g on RCSB PDB site
Description: Crystal structure of K12V/C16S/C117V/P134V mutant of human acidic fibroblast growth factor
Class: protein binding
Keywords: Beta-trefoil, growth factor, FGFR binding, heparin binding, extracellular matrix, PROTEIN BINDING
Deposited on 2014-05-01, released 2015-03-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-03-11, with a file datestamp of 2015-03-06.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (17)
      • engineered mutation (21)
      • engineered mutation (122)
      • engineered mutation (139)
    Domains in SCOPe 2.06: d4q9ga1, d4q9ga2
  • Chain 'B':
    Compound: fibroblast growth factor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: FGF1, FGFA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05230
      • engineered mutation (17)
      • engineered mutation (21)
      • engineered mutation (122)
      • engineered mutation (139)
    Domains in SCOPe 2.06: d4q9gb1, d4q9gb2
  • Heterogens: FMT, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q9gA (A:)
    hhhhhhfnlppgnykkpvllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflvlpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q9gA (A:)
    hhhhhfnlppgnykkpvllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    svkrgprthygqkailflvlpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q9gB (B:)
    hhhhhhfnlppgnykkpvllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgev
    yikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkn
    gsvkrgprthygqkailflvlpvssd
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q9gB (B:)
    hhhhhfnlppgnykkpvllyssngghflrilpdgtvdgtrdrsdqhiqlqlsaesvgevy
    ikstetgqylamdtdgllygsqtpneeclflerleenhyntyiskkhaeknwfvglkkng
    svkrgprthygqkailflvlpv