PDB entry 4q9c

View 4q9c on RCSB PDB site
Description: IgNAR antibody domain C3
Class: immune system
Keywords: protein evolution, antibody structure, protein folding, IMMUNE SYSTEM
Deposited on 2014-04-30, released 2014-07-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.26
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: novel antigen receptor
    Species: Ginglymostoma cirratum [TaxId:7801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d4q9ca_
  • Heterogens: PG4, CL, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >4q9cA (A:)
garveptkphlrllppspeeiqstssatltclirgfypdkvsvswqkddvsvsanvtnfp
taleqdltfstrsllnltavewksgakytctashppsqstvkrvirnqkvd

    Sequence, based on observed residues (ATOM records): (download) 
    >4q9cA (A:)
veptkphlrllppspeeiqstssatltclirgfypdkvsvswqkddvsvsanvtnfptal
eqdltfstrsllnltavewksgakytctashppsqstvkrvirnq