PDB entry 4q97

View 4q97 on RCSB PDB site
Description: IgNAR antibody domain C1
Class: immune system
Keywords: protein evolution, antibody structure, protein folding, IMMUNE SYSTEM
Deposited on 2014-04-29, released 2014-07-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-02, with a file datestamp of 2014-06-27.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.266
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: novel antigen receptor
    Species: Ginglymostoma cirratum [TaxId:7801]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90544 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.04: d4q97a_
  • Chain 'B':
    Compound: novel antigen receptor
    Species: Ginglymostoma cirratum [TaxId:7801]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q90544 (4-End)
      • expression tag (1-3)
    Domains in SCOPe 2.04: d4q97b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q97A (A:)
    gshmgippsppivsllhsateeqranrfvqlvclisgyypeniavswqkntktitsgfat
    tspvktssndfscasllkvplqewsrgsvyscqvshsatssnqrkeirsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q97A (A:)
    shmgippsppivsllhsateeqranrfvqlvclisgyypeniavswqkntktitsgfatt
    spvktssndfscasllkvplqewsrgsvyscqvshsatssnqrkeirs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q97B (B:)
    gshmgippsppivsllhsateeqranrfvqlvclisgyypeniavswqkntktitsgfat
    tspvktssndfscasllkvplqewsrgsvyscqvshsatssnqrkeirsts
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q97B (B:)
    shmgippsppivsllhsateeqranrfvqlvclisgyypeniavswqkntktitsgfatt
    spvktssndfscasllkvplqewsrgsvyscqvshsatssnqrkeirs