PDB entry 4q89

View 4q89 on RCSB PDB site
Description: Crystal Structure of the CotA native enzyme
Class: oxidoreductase
Keywords: laccase, Oxidoreductase
Deposited on 2014-04-26, released 2015-04-29
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-29, with a file datestamp of 2015-04-24.
Experiment type: XRAY
Resolution: 2.31 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: spore coat protein a
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: cotA, pig, BSU06300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q89a1, d4q89a2, d4q89a3
  • Chain 'B':
    Compound: spore coat protein a
    Species: Bacillus subtilis subsp. subtilis str. 168 [TaxId:224308]
    Gene: cotA, pig, BSU06300
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q89b1, d4q89b2, d4q89b3
  • Heterogens: CU, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q89A (A:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
    awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
    rlklpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvw
    pyleveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaery
    diiidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyps
    vqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthp
    ihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaat
    fgpysgryvwhchilehedydmmrpmditdphk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q89A (A:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihqheepevktvvhlhggvtpddsdgypeawfs
    kdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrlkl
    psdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpyle
    veprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydiii
    dftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyiqnirt
    lklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihlhlvsfrvl
    drrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgpysgryvwh
    chilehedydmmrpmditdph
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q89B (B:)
    mtlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgpti
    evkrnenvyvkwmnnlpsthflpidhtihhsdsqheepevktvvhlhggvtpddsdgype
    awfskdfeqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkek
    rlklpsdeydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvw
    pyleveprkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaery
    diiidftayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasyps
    vqheriqnirtlklagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthp
    ihlhlvsfrvldrrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaat
    fgpysgryvwhchilehedydmmrpmditdphk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q89B (B:)
    tlekfvdalpipdtlkpvqqskektyyevtmeecthqlhrdlpptrlwgynglfpgptie
    vkrnenvyvkwmnnlpsthflpidhtiheepevktvvhlhggvtpddsdgypeawfskdf
    eqtgpyfkrevyhypnqqrgailwyhdhamaltrlnvyaglvgayiihdpkekrlklpsd
    eydvpllitdrtinedgslfypsapenpspslpnpsivpafcgetilvngkvwpylevep
    rkyrfrvinasntrtynlsldnggdfiqigsdggllprsvklnsfslapaerydiiidft
    ayegesiilansagcggdvnpetdanimqfrvtkplaqkdesrkpkylasypriqnirtl
    klagtqdeygrpvlllnnkrwhdpvtetpkvgtteiwsiinptrgthpihlhlvsfrvld
    rrpfdiaryqesgelsytgpavppppsekgwkdtiqahagevlriaatfgpysgryvwhc
    hilehedydmmrpmditdp