PDB entry 4q7t

View 4q7t on RCSB PDB site
Description: Crystal structure of photoswitchable fluorescent protein PSmOrange
Class: fluorescent protein
Keywords: beta-barrel, photoswitchable fluorescent protein, chromophore, FLUORESCENT PROTEIN
Deposited on 2014-04-25, released 2014-07-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.203
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PSmOrange
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VWW2
      • engineered mutation (37)
      • engineered mutation (80)
      • chromophore (81)
      • engineered mutation (112)
      • engineered mutation (137)
      • engineered mutation (175)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d4q7ta_
  • Chain 'B':
    Compound: PSmOrange
    Species: DISCOSOMA SP. [TaxId:86600]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D0VWW2
      • engineered mutation (37)
      • engineered mutation (80)
      • chromophore (81)
      • engineered mutation (112)
      • engineered mutation (137)
      • engineered mutation (175)
      • engineered mutation (199)
    Domains in SCOPe 2.06: d4q7tb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q7tA (A:)
    mgshhhhhhgrsmvskgeennmaiikefmrfkvrmegtvnghefeiegegegrpyegfqt
    aklkvtkggplpfawdilsplxskayvkhpadipdyfklsfpegfkwervmnyedggvvt
    vtqdsslqdgefiykvkmrgtnfpsdgpvmqkktmgweassermypedgalkgeirmrlk
    lkdgghytsevkttykakksvqlpgayivgiklditshnedytiveqyeraegrhstggm
    delyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7tA (A:)
    aiikefmrfkvrmegtvnghefeiegegegrpyegfqtaklkvtkggplpfawdilsplx
    skayvkhpadipdyfklsfpegfkwervmnyedggvvtvtqdsslqdgefiykvkmrgtn
    fpsdgpvmqkktmgweassermypedgalkgeirmrlklkdgghytsevkttykakksvq
    lpgayivgiklditshnedytiveqyeraegrhst
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q7tB (B:)
    mgshhhhhhgrsmvskgeennmaiikefmrfkvrmegtvnghefeiegegegrpyegfqt
    aklkvtkggplpfawdilsplxskayvkhpadipdyfklsfpegfkwervmnyedggvvt
    vtqdsslqdgefiykvkmrgtnfpsdgpvmqkktmgweassermypedgalkgeirmrlk
    lkdgghytsevkttykakksvqlpgayivgiklditshnedytiveqyeraegrhstggm
    delyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7tB (B:)
    aiikefmrfkvrmegtvnghefeiegegegrpyegfqtaklkvtkggplpfawdilsplx
    skayvkhpadipdyfklsfpegfkwervmnyedggvvtvtqdsslqdgefiykvkmrgtn
    fpsdgpvmqkktmgweassermypedgalkgeirmrlklkdgghytsevkttykakksvq
    lpgayivgiklditshnedytiveqyeraegrhstgg