PDB entry 4q7d

View 4q7d on RCSB PDB site
Description: Wild type Fc (wtFc)
Class: immune system
Keywords: Immunoglobulin Fold, IMMUNE SYSTEM
Deposited on 2014-04-24, released 2014-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q7da1, d4q7da2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q7db1, d4q7db2
  • Heterogens: MAN, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q7dA (A:)
    cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7dA (A:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrde
    ltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrw
    qqgnvfscsvmhealhnhytqkslsls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q7dB (B:)
    cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q7dB (B:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsl