PDB entry 4q74

View 4q74 on RCSB PDB site
Description: F241A Fc
Class: immune system
Keywords: immune system
Deposited on 2014-04-24, released 2014-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.206
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (24)
    Domains in SCOPe 2.06: d4q74a1, d4q74a2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01857
      • engineered mutation (24)
    Domains in SCOPe 2.06: d4q74b1, d4q74b2
  • Heterogens: BMA, FUC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q74A (A:)
    evqlletstcppcpapellggpsvalfppkpkdtlmisrtpevtcvvvdvshedpevkfn
    wyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiekti
    skakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttpp
    vldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q74A (A:)
    papellggpsvalfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnakt
    kpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvy
    tlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflysk
    ltvdksrwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q74B (B:)
    evqlletstcppcpapellggpsvalfppkpkdtlmisrtpevtcvvvdvshedpevkfn
    wyvdgvevhnaktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiekti
    skakgqprepqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttpp
    vldsdgsfflyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q74B (B:)
    gpsvalfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
    nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsrd
    eltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksr
    wqqgnvfscsvmhealhnhytqkslsl