PDB entry 4q6y

View 4q6y on RCSB PDB site
Description: Crystal structure of a chemoenzymatic glycoengineered disialylated Fc (di-sFc)
Class: immune system
Keywords: immune system
Deposited on 2014-04-23, released 2014-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.26
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q6ya1, d4q6ya2
  • Chain 'B':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q6yb1, d4q6yb2
  • Chain 'C':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q6yc1, d4q6yc2
  • Chain 'D':
    Compound: Ig gamma-1 chain C region
    Species: Homo sapiens [TaxId:9606]
    Gene: IGHG1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q6yd1, d4q6yd2
  • Heterogens: NAG, SIA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q6yA (A:)
    cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q6yA (A:)
    ggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeq
    ynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqprepqvytlppsr
    deltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdks
    rwqqgnvfscsvmhealhnhytqkslsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q6yB (B:)
    cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q6yB (B:)
    psvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyn
    styrvvsvltvlhqdwlngkeykckvsnkalppiektiskakgqprepqvytlppsrdel
    tknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwq
    qgnvfscsvmhealhnhytqkslsls
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4q6yC (C:)
    cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q6yC (C:)
    psvflfppkpkdtlmsrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqyns
    tyrvvsvltvlhqdwlngkeykckvsnektiskakgqprepqvytlppsrdeltknqvsl
    tclvkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfsc
    svmhealhnhytqkslsls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4q6yD (D:)
    cppcpapellggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevh
    naktkpreeqynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakgqpre
    pqvytlppsrdeltknqvsltclvkgfypsdiavewesngqpennykttppvldsdgsff
    lyskltvdksrwqqgnvfscsvmhealhnhytqkslslspg
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q6yD (D:)
    psvflfppkpkdtlmisrtpevtcvvpevkfnwyvdgvevhnaktkpreeqynrvvsvlt
    vlhqdwlngkeykckvskalpapiektiskakgqprepqvytlppsrdeltknqvsltcl
    vkgfypsdiavewesngqpennykttppvldsdgsfflyskltvdksrwqqgnvfscsvm
    healhnhytqkslsl