PDB entry 4q6g

View 4q6g on RCSB PDB site
Description: Crystal Structure of the C-terminal domain of AcKRS-1 bound with N-acetyl-lysine and ADPNP
Deposited on 2014-04-22, released 2014-11-12
The last revision was dated 2014-12-10, with a file datestamp of 2014-12-05.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.187
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyrrolysine--tRNA ligase
    Species: Methanosarcina mazei [TaxId:192952]
    Gene: pylS, MM_1445
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8PWY1 (0-266)
      • engineered mutation (113)
      • engineered mutation (117-118)
      • engineered mutation (121)
      • engineered mutation (160)
      • engineered mutation (194)
  • Heterogens: ANP, EDO, ALY, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >4q6gA (A:)
paltksqtdrlevllnpkdeislnsgkpfrelesellsrrkkdlqqiyaeerenylgkle
reitrffvdrgfleikspilipleyiermgidndtelskqifrvdknfclrpmvapnifn
yarkldralpdpikifeigpcyrkesdgkehleeftmlnffqmgsgctrenlesiitdfl
nhlgidfkivgdscsvygdtldvmhgdlelssavvgpipldrewgidkpwigagfglerl
lkvkhdfknikraarsesyyngistnl