PDB entry 4q63

View 4q63 on RCSB PDB site
Description: Crystal Structure of Legionella Uncharacterized Protein Lpg0364
Deposited on 2014-04-21, released 2014-05-07
The last revision was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.185
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized protein Lpg0364
    Species: Legionella pneumophila subsp. pneumophila [TaxId:272624]
    Gene: lpg0364
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CD, FMT, EDO, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >4q63A (A:)
ghmderrkyfrlknhgeinasldnnsieiveissngavvvkqktdipkegvlklqihnfi
melcyeviraednnivlhftkedetnklflvlkrlrderknktgs

    Sequence, based on observed residues (ATOM records):
    >4q63A (A:)
yfrlknhgeinasldnnsieiveissngavvvkqktdipkegvlklqihnfimelcyevi
raednnivlhftkedetnklflvlkrlrderkn