PDB entry 4q5s

View 4q5s on RCSB PDB site
Description: RPase in complex with DNA and RNA
Class: transcription/DNA/rna
Keywords: transcription, transcription-DNA-rna complex
Deposited on 2014-04-17, released 2014-07-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2014-07-09, with a file datestamp of 2014-07-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.27
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: DNA-directed RNA polymerase subunit alpha
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: DNA-directed RNA polymerase subunit beta
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d4q5sc_
  • Chain 'D':
    Compound: DNA-directed RNA polymerase subunit beta'
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: DNA-directed RNA polymerase subunit omega
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: RNA polymerase sigma factor SigA
    Species: Thermus thermophilus [TaxId:300852]
    Gene: sigA, TTHA0532
    Database cross-references and differences (RAF-indexed):
  • Chain 'G':
    Compound: DNA (5'-d(*cp*cp*tp*gp*cp*ap*tp*cp*cp*gp*tp*gp*ap*gp*tp*gp*cp*ap*gp*cp*cp*a)-3')
  • Chain 'H':
    Compound: DNA (5'-d(*tp*ap*tp*ap*ap*tp*gp*gp*gp*ap*gp*cp*tp*gp*tp*cp*ap*cp*gp*gp*ap*tp*gp*cp*ap*gp*g)-3')
  • Chain 'I':
    Compound: RNA (5'-r(p*cp*up*cp*ap*c)-3')
  • Heterogens: MG, ZN, ATP

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4q5sC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieeedkg
    kgglvldfleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghipl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepng
    vvsmkvnkrkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlft
    llrpgdppkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrerml
    mgsedsltpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvt
    devvymtateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvf
    svntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevakvdgnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpa
    sengflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifge
    kardvkdtslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispifdgakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpe
    eqlkelflqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q5sC (C:)
    meikrfgrireviplpplteiqvesyrralqadvppekrenvgiqaafretfpieelvld
    fleyrlgeppfpqdecrekdltyqaplyarlqlihkdtglikedevflghiplmtedgsf
    iingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidlevepngvvsmkvn
    krkfplvlllrvlgydqetlarelgaygelvqglmdesvfamrpeealirlftllrpgdp
    pkrdkavayvygliadprrydlgeagrykaeeklgirlsgrtlarfedgefkdevflptl
    rylfaltagvpghevddidhlgnrrirtvgelmtdqfrvglarlargvrermlmgsedsl
    tpaklvnsrpleaaireffsrsqlsqfkdetnplsslrhkrrisalgpggltreragfdv
    rdvhrthygricpvetpeganiglitslaayarvdelgfirtpyrrvvggvvtdevvymt
    ateedrytiaqantplegnriaaervvarrkgepvivspeevefmdvspkqvfsvntnli
    pflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeedgevakvd
    gnrivvryedgrlveyplrrfyrsnqgtaldqrprvvvgqrvrkgdlladgpasengfla
    lgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgperitrdip
    hlseaalrdldeegvvrigaevkpgdilvgrtsfkgeseptpeerllrsifgekardvkd
    tslrvppgeggivvrtvrlrrgdpgvelkpgvrevvrvyvaqkrklqvgdklanrhgnkg
    vvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqryispifd
    gakepeikellaqafevyfgkrkgegfgvdkrevevlrraeklglvtpgktpeeqlkelf
    lqgkvvlydgrtgepiegpivvgqmfimklyhmvedkmharstgpyslitqqplggkaqf
    ggqrfgemevwaleaygaahtlqemltlksddiegrnaayeaiikgedvpepsvpesfrv
    lvkelqalaldvqtldekdnpvdifeglask
    

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.