PDB entry 4q5p

View 4q5p on RCSB PDB site
Description: Lysine-Ligated Yeast Iso-1 Cytochrome C
Class: electron transport
Keywords: electron transport
Deposited on 2014-04-17, released 2015-04-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-22, with a file datestamp of 2015-04-17.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (0-105)
      • conflict (74)
      • engineered mutation (80-81)
      • conflict (104)
    Domains in SCOPe 2.05: d4q5pa_
  • Chain 'B':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-105)
      • conflict (74)
      • engineered mutation (80-81)
      • conflict (104)
    Domains in SCOPe 2.05: d4q5pb_
  • Chain 'C':
    Compound: Cytochrome c iso-1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: CYC1, YJR048W, J1653
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00044 (Start-105)
      • conflict (74)
      • engineered mutation (80-81)
      • conflict (104)
    Domains in SCOPe 2.05: d4q5pc_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q5pA (A:)
    fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
    lwdennmseyltnpakyipgcgmafgglkkekdrndlitylkkase
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q5pB (B:)
    fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
    lwdennmseyltnpakyipgcgmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q5pB (B:)
    agsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlw
    dennmseyltnpakyipgcgmafgglkkekdrndlitylkkase
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4q5pC (C:)
    fkagsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknv
    lwdennmseyltnpakyipgcgmafgglkkekdrndlitylkkase
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q5pC (C:)
    agsakkgatlfktrclqchtvekggphkvgpnlhgifgrhsgqaegysytdanikknvlw
    dennmseyltnpakyipgcgmafgglkkekdrndlitylkkase