PDB entry 4q5n

View 4q5n on RCSB PDB site
Description: Crystal structure of the gluthatione S-transferase Blo t 8
Class: transferase
Keywords: transferase
Deposited on 2014-04-17, released 2015-04-01
The last revision prior to the SCOPe 2.05 freeze date was dated 2015-04-01, with a file datestamp of 2015-03-27.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gluthatione S-transferase Blo t 8 isoform
    Species: Blomia tropicalis [TaxId:40697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q5na1, d4q5na2
  • Chain 'B':
    Compound: Gluthatione S-transferase Blo t 8 isoform
    Species: Blomia tropicalis [TaxId:40697]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4q5nb1, d4q5nb2
  • Heterogens: GSH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q5nA (A:)
    maplkigywdvrgfaepirmllkhlniefeetrygfgndseeslpnrdewlaekftlgle
    fpnlpylfdgdfkmtesvailkrlarangmiattepalsysemieamiidirnrlinvvy
    aensgtpeefeqkladlrerletslgqleaffqkhgsqwvagdkltyvdflayeyldwyr
    vfvkstpifekfakvsdymkrfeelpslkeyiardehrsasclspfarighrwake
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q5nA (A:)
    plkigywdvrgfaepirmllkhlniefeetrygflpnrdewlaekftlglefpnlpylfd
    gdfkmtesvailkrlarangmiattepalsysemieamiidirnrlinvvyaetpeefeq
    kladlrerletslgqleaffqkhgsqwvagdkltyvdflayeyldwyrvfvkstpifekf
    akvsdymkrfeelpslkeyiardehrsasclspfarighr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q5nB (B:)
    maplkigywdvrgfaepirmllkhlniefeetrygfgndseeslpnrdewlaekftlgle
    fpnlpylfdgdfkmtesvailkrlarangmiattepalsysemieamiidirnrlinvvy
    aensgtpeefeqkladlrerletslgqleaffqkhgsqwvagdkltyvdflayeyldwyr
    vfvkstpifekfakvsdymkrfeelpslkeyiardehrsasclspfarighrwake
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q5nB (B:)
    lkigywdvrgfaepirmllkhlniefeetrygflpnrdewlaekftlglefpnlpylfdg
    dfkmtesvailkrlarangmiattepalsysemieamiidirnrlinvvyaetpeefeqk
    ladlrerletslgqleaffqkhgsqwvagdkltyvdflayeyldwyrvfvkstpifekfa
    kvsdymkrfeelpslkeyiardehrsasclspfarigh