PDB entry 4q5h
View 4q5h on RCSB PDB site
Description: Shigella Effector Kinase OspG bound to AMPPNP and E2-Ub UbcH7-Ub Conjugate
Class: unknown function, protein binding
Keywords: protein-protein complex, Structural Genomics, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, kinase fold, inhibition of NF-kB pathway, UNKNOWN FUNCTION, PROTEIN BINDING
Deposited on
2014-04-16, released
2014-07-02
The last revision prior to the SCOPe 2.05 freeze date was dated
2014-07-02, with a file datestamp of
2014-06-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.38
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein kinase ospg
Species: Shigella sonnei [TaxId:300269]
Gene: ospG, SSON_P170
Database cross-references and differences (RAF-indexed):
- Chain 'B':
Compound: Polyubiquitin
Species: Saccharomyces cerevisiae [TaxId:559292]
Gene: SCD2, UBE2L3, UBI4, YLL039C
Database cross-references and differences (RAF-indexed):
- Uniprot P0CG63 (0-75)
- engineered mutation (47)
- engineered mutation (75)
Domains in SCOPe 2.05: d4q5hb_ - Chain 'C':
Compound: Ubiquitin-conjugating enzyme E2 L3
Species: Homo sapiens [TaxId:9606]
Gene: UBCE7, UBCH7, UBE2L3, UBI4
Database cross-references and differences (RAF-indexed):
- Uniprot P68036 (2-155)
- expression tag (1)
- engineered mutation (18)
- engineered mutation (138)
Domains in SCOPe 2.05: d4q5hc_ - Heterogens: MG, ANP, HOH
PDB Chain Sequences:
- Chain 'A':
No sequence available.
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>4q5hB (B:)
mqifvktltgktitlevessdtidnvkskiqdkegippdqqrlifagrqledgrtlsdyn
iqkestlhlvlrlrgc
- Chain 'C':
Sequence, based on SEQRES records: (download)
>4q5hC (C:)
ghmaasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfp
aeypfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpe
hplradlaeeyskdrkkfsknaeeftkkygekrpvd
Sequence, based on observed residues (ATOM records): (download)
>4q5hC (C:)
hmaasrrlmkeleeirksgmknfrniqvdeanlltwqglivpdnppydkgafrieinfpa
eypfkppkitfktkiyhpnidekgqvclpvisaenwkpatktdqviqslialvndpqpeh
plradlaeeyskdrkkfsknaeeftkkygekrpvd