PDB entry 4q56

View 4q56 on RCSB PDB site
Description: Structure of Helix aspersa agglutinin with natural glycosylation and N-acetyl-alpha-D-galactosamine (GalNAc)
Class: sugar binding protein
Keywords: carbohydrate-binding protein, sugar binding protein, h-type lectin, snail mucus
Deposited on 2014-04-16, released 2015-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Helix aspersa agglutinin (HAA)
  Species: Helix aspersa [TaxId:6535]
  Database cross-references and differences (RAF-indexed):
  • PDB 4Q56 (0-100)
  Domains in SCOPe 2.08: d4q56a_
• Heterogens: ACT, A2G, NA, ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >4q56A (A:)
  ervqsgkidcgndvswakvpsddpgrdntrelaknitfaspycrppvvllsitqldveqs
  qnlrviarlysvsptgfkascytwhntkvysmsiswisien