PDB entry 4q55

View 4q55 on RCSB PDB site
Description: Crystal structure of peptidyl-tRNA hydrolase from a Gram-positive bacterium, Streptococcus pyogenes at 2.19A resolution shows the closed structure of the substrate binding cleft
Class: hydrolase
Keywords: Peptidyl-tRNA hydrolase, hydrolase, peptidyl-tRNA
Deposited on 2014-04-16, released 2014-05-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-08-06, with a file datestamp of 2014-08-01.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: 0.184
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-tRNA hydrolase
    Species: Streptococcus pyogenes [TaxId:471876]
    Gene: pth, Spy49_0005
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q55a_
  • Chain 'B':
    Compound: Peptidyl-tRNA hydrolase
    Species: Streptococcus pyogenes [TaxId:471876]
    Gene: pth, Spy49_0005
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q55b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q55A (A:)
    mvkmivglgnpgskyektkhnigfmaidnivknldvtftddknfkaqigstfinhekvyf
    vkpttfmnnsgiavkalltyyniditdliviyddldmevsklrlrskgsagghngiksii
    ahigtqefnrikvgigrplkgmtvinhvmgqfntedniaisltldrvvnavkfylqendf
    ektmqkfng
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4q55B (B:)
    mvkmivglgnpgskyektkhnigfmaidnivknldvtftddknfkaqigstfinhekvyf
    vkpttfmnnsgiavkalltyyniditdliviyddldmevsklrlrskgsagghngiksii
    ahigtqefnrikvgigrplkgmtvinhvmgqfntedniaisltldrvvnavkfylqendf
    ektmqkfng