SCOPe 2.05: Structural Classification of Proteins

PDB entry 4q31

View 4q31 on RCSB PDB site
Description: The crystal structure of cystathione gamma lyase (CalE6) from Micromonospora echinospora
Class: lyase
Keywords: structural genomics, PSI-Biology, protein structure initiative, midwest center for structural genomics, MCSG, Enzyme Discovery for Natural Product Biosynthesis, NatPro, LYASE
Deposited on 2014-04-10, released 2014-05-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-05-07, with a file datestamp of 2014-05-02.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.153
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: cystathione gamma lyase CalE6
Species: Micromonospora echinospora [TaxId:1877]
Gene: calE6
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KNG3
  - engineered mutation (9)
Domains in SCOPe 2.05: d4q31a_
Chain 'B':
Compound: cystathione gamma lyase CalE6
Species: Micromonospora echinospora [TaxId:1877]
Gene: calE6
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KNG3
  - engineered mutation (9)
Domains in SCOPe 2.05: d4q31b_
Chain 'C':
Compound: cystathione gamma lyase CalE6
Species: Micromonospora echinospora [TaxId:1877]
Gene: calE6
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KNG3 (Start-383)
  - engineered mutation (9)
Domains in SCOPe 2.05: d4q31c_
Chain 'D':
Compound: cystathione gamma lyase CalE6
Species: Micromonospora echinospora [TaxId:1877]
Gene: calE6
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KNG3
  - engineered mutation (9)
Domains in SCOPe 2.05: d4q31d_
Chain 'E':
Compound: cystathione gamma lyase CalE6
Species: Micromonospora echinospora [TaxId:1877]
Gene: calE6
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KNG3
  - engineered mutation (9)
Domains in SCOPe 2.05: d4q31e_
Chain 'F':
Compound: cystathione gamma lyase CalE6
Species: Micromonospora echinospora [TaxId:1877]
Gene: calE6
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KNG3
  - engineered mutation (9)
Domains in SCOPe 2.05: d4q31f_
Chain 'G':
Compound: cystathione gamma lyase CalE6
Species: Micromonospora echinospora [TaxId:1877]
Gene: calE6
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KNG3
  - engineered mutation (9)
Domains in SCOPe 2.05: d4q31g_
Chain 'H':
Compound: cystathione gamma lyase CalE6
Species: Micromonospora echinospora [TaxId:1877]
Gene: calE6
Database cross-references and differences (RAF-indexed):
- Uniprot Q8KNG3
  - engineered mutation (9)
Domains in SCOPe 2.05: d4q31h_
Heterogens: MES, CL, GOL, FMT, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>4q31A (A:)
snamsgmrfgtrlvhggrrpsagtgdvvppihvsttyerraqdepryfygrgenptreel
eeclaglerapfatvfssgqaaaatllslvrpgqcvvstddvyagtdglfdlaarqgvrv
ryadlttpegiaaalaepdlalvwietptnplltvvdvaevsrrahergarvvvdntfas
pvlqqplalgadvslysttksiaghadvlggalvyrdadlhaavrayrttagnvpgaldc
flvrrglhtlslrvhrqvatarvlverlraspvvgavhypglpehpqhavvkaqmsapga
ivsfdylggpaerlldrftlftcgvslggvhslvecpalmthrplsaeararrgigesli
rlsvgiedpqdlaedlsralaggt