PDB entry 4q2r

View 4q2r on RCSB PDB site
Description: Structural Proteomics From Crude Native Rod Outer Segments
Class: transferase
Keywords: kinase, Brain, TRANSFERASE
Deposited on 2014-04-09, released 2014-09-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2014-09-03, with a file datestamp of 2014-08-29.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.223
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Creatine kinase B-type
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q2ra1, d4q2ra2
  • Chain 'B':
    Compound: Creatine kinase B-type
    Species: Bos taurus [TaxId:9913]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d4q2rb1, d4q2rb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q2rA (A:)
    mpfsnshntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtg
    vdnpghpyimtvgcvagdeesydvfkelfdpiiedrhggykptdehktdlnpdnlqggdd
    ldpnyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmt
    eaeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvism
    qkggnmkevftrfcngltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklp
    hlgkhekfpevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvkll
    iemeqrleqgqaiddlmpaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q2rA (A:)
    shnlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgvdnpgh
    pyimtvgcvagdeesydvfkelfdpiiedrhggykptdehktdlnpdnlqggddldpnyv
    lssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmteaeqqq
    liddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvismqkggnm
    kevftrfcngltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklphlgkhe
    kfpevlkrlrlqkrgggvfdvsnadrlgfsevelvqmvvdgvklliemeqrleqgqaidd
    lmpaqk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q2rB (B:)
    mpfsnshntlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtg
    vdnpghpyimtvgcvagdeesydvfkelfdpiiedrhggykptdehktdlnpdnlqggdd
    ldpnyvlssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmt
    eaeqqqliddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvism
    qkggnmkevftrfcngltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklp
    hlgkhekfpevlkrlrlqkrgtggvdtaavggvfdvsnadrlgfsevelvqmvvdgvkll
    iemeqrleqgqaiddlmpaqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q2rB (B:)
    shnlklrfpaedefpdlsghnnhmakvltpelyaelrakstpsgftvddviqtgvdnpgh
    pyimtvgcvagdeesydvfkelfdpiiedrhggykptdehktdlnpdnlqggddldpnyv
    lssrvrtgrsirgfclpphcsrgerraieklavealssldgdlagryyalksmteaeqqq
    liddhflfdkpvsplllasgmardwpdargiwhndnktflvwineedhlrvismqkggnm
    kevftrfcngltqietlfksknyefmwnphlgyiltcpsnlgtglragvhiklphlgkhe
    kfpevlkrlrlqkrgggvfdvsnadrlgfsevelvqmvvdgvklliemeqrleqgqaidd
    lmpaqk