PDB entry 4q2k

View 4q2k on RCSB PDB site
Description: Bovine alpha chymotrypsin bound to a cyclic peptide inhibitor, 5b
Class: hydrolase/hydrolase inhibitor
Keywords: chymotrypsin, protease, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2014-04-09, released 2014-07-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q2ka_
  • Chain 'B':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q2kb_
  • Chain 'C':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q2kc_
  • Chain 'D':
    Compound: chymotrypsinogen a
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d4q2kd_
  • Heterogens: 5BF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4q2kA (A:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q2kA (A:)
    cgvpaiqpvlivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
    vvagefdqgsssekiqklkiakvfknsknditllklstaasfsqtvsavclpsasddfaa
    gttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmgd
    sggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4q2kB (B:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q2kB (B:)
    cgvpaiqpvlsivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsd
    vvvagefdqgsssekiqklkiakvfknsinnditllklstaasfsqtvsavclpsasddf
    aagttcvttgwgltrytpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmgd
    sggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4q2kC (C:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q2kC (C:)
    cgvpaiqpvlivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
    vvagefdqgsssekiqklkiakvfknskynnnditllklstaasfsqtvsavclpsasdd
    faagttcvttgwgltryantpdrlqqaslpllsntnckkywgtkikdamicagasgvssc
    mgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4q2kD (D:)
    cgvpaiqpvlsglsrivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgv
    ttsdvvvagefdqgsssekiqklkiakvfknskynsltinnditllklstaasfsqtvsa
    vclpsasddfaagttcvttgwgltrytnantpdrlqqaslpllsntnckkywgtkikdam
    icagasgvsscmgdsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqq
    tlaan
    

    Sequence, based on observed residues (ATOM records): (download)
    >4q2kD (D:)
    cgvpaiqpvlivngeeavpgswpwqvslqdktgfhfcggslinenwvvtaahcgvttsdv
    vvagefdqgsssekiqklkiakvfknskinnditllklstaasfsqtvsavclpsasddf
    aagttcvttgwgltryntpdrlqqaslpllsntnckkywgtkikdamicagasgvsscmg
    dsggplvckkngawtlvgivswgsstcststpgvyarvtalvnwvqqtlaan